PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA01G40640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 251aa    MW: 26493 Da    PI: 6.9406
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA01G40640.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.61.4e-40591581100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++C++apyf  ++p+kfa+vhk+FGasnv+k+l ++ e er da+sslvyeA+ r+rdPvyG++g i+ lqqq++ l+ael
  ONIVA01G40640.1  59 PCAACKLLRRRCAQECPFAPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGEAERADAASSLVYEANLRLRDPVYGCMGAISMLQQQVNALEAEL 152
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++++e
  ONIVA01G40640.1 153 EAVRAE 158
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.17158159IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4059156IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MSTERERLDE IGKKIKREPD TAGVVVAAVA GTGTGTATPI EHRVPHRLGL GGAVNTVTPC  60
AACKLLRRRC AQECPFAPYF SPHEPHKFAA VHKVFGASNV SKMLLEVGEA ERADAASSLV  120
YEANLRLRDP VYGCMGAISM LQQQVNALEA ELEAVRAEIF KRRYRQAGAA TGLMDDVQVH  180
ITAGFAAPPP PPSMHARDVV SVADAGGQGQ ELAGAPVISS ASPPVYPAGQ PSTSTTDYSS  240
LNTSEHAAYF G
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1219190.0AK121919.1 Oryza sativa Japonica Group cDNA clone:J033106D14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636038.10.0PREDICTED: LOB domain-containing protein 15
SwissprotQ9AT615e-71LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A0D3EVQ20.0A0A0D3EVQ2_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9YGR20.0A0A0D9YGR2_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0FV620.0A0A0E0FV62_ORYNI; Uncharacterized protein
TrEMBLA0A0E0N4D00.0A0A0E0N4D0_ORYRU; Uncharacterized protein
TrEMBLB8ABL70.0B8ABL7_ORYSI; Putative uncharacterized protein
TrEMBLQ5QMB40.0Q5QMB4_ORYSJ; Os01g0825000 protein
STRINGBGIOSGA004719-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os01g60960.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-65LOB domain-containing protein 15